RIT2 (NM_002930) Human Recombinant Protein
CAT#: TP305367
Recombinant protein of human Ras-like without CAAX 2 (RIT2), 20 µg
View other "RIT2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205367 protein sequence
Red=Cloning site Green=Tags(s) MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYL DILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQF RQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLK KKRENMT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002921 |
Locus ID | 6014 |
UniProt ID | Q99578 |
Refseq Size | 1102 |
Cytogenetics | 18q12.3 |
Refseq ORF | 651 |
Synonyms | RIBA; RIN; ROC2 |
Summary | RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 [PubMed 10545207]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401022 | RIT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401022 | Transient overexpression lysate of Ras-like without CAAX 2 (RIT2) |
CNY 3,080.00 |
|
PH305367 | RIT2 MS Standard C13 and N15-labeled recombinant protein (NP_002921) |
CNY 19,520.00 |