C1orf19 (TSEN15) (NM_052965) Human Recombinant Protein

CAT#: TP305519

Recombinant protein of human tRNA splicing endonuclease 15 homolog (S. cerevisiae) (TSEN15), transcript variant 1, 20 µg

Size: 20 ug 100 ug 1 mg



  View other "C1orf19" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


TSEN15 mouse monoclonal antibody,clone OTI5A3
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC205519 protein sequence
Red=Cloning site Green=Tags(s)

MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDL
MESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFT
LAIVESDSTIVYYKLTDGFMLPDPQNISLRR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_443197
Locus ID 116461
UniProt ID Q8WW01
Refseq Size 1998
Cytogenetics 1q25.3
Refseq ORF 513
Synonyms C1orf19; PCH2F; sen15
Summary This gene encodes a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns from tRNA precursors. Alternative splicing results in multiple transcript variants. There is a pseudogene of this gene on chromosome 17. [provided by RefSeq, Jul 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...