C6orf57 (SDHAF4) (NM_145267) Human Recombinant Protein
CAT#: TP305542
Recombinant protein of human chromosome 6 open reading frame 57 (C6orf57), 20 µg
View other "C6orf57" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205542 protein sequence
Red=Cloning site Green=Tags(s) MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPMLPEGRFDAPEDSHLEKEP LEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660310 |
Locus ID | 135154 |
UniProt ID | Q5VUM1 |
Refseq Size | 526 |
Cytogenetics | 6q13 |
Refseq ORF | 324 |
Synonyms | C6orf57; Sdh8 |
Summary | Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol (PubMed:24954416). Binds to the flavoprotein subunit SDHA in its FAD-bound form, blocking the generation of excess reactive oxigen species (ROS) and facilitating its assembly with the iron-sulfur protein subunit SDHB into the SDH catalytic dimer (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407992 | SDHAF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407992 | Transient overexpression lysate of chromosome 6 open reading frame 57 (C6orf57) |
CNY 3,080.00 |
|
PH305542 | C6orf57 MS Standard C13 and N15-labeled recombinant protein (NP_660310) |
CNY 19,520.00 |
其它C6orf57产品