United States
Germany
Japan
United Kingdom
China
NT5C3 (NT5C3A) (NM_016489) Human Recombinant Protein
CAT＃: TP305629
Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, 20 µg
View other "NT5C3" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205629 protein sequence
Red=Cloning site Green=Tags(s) MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNI IDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDV MLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHV FNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVL VQDESLEVANSILQKIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057573 |
| Locus ID | 51251 |
| UniProt ID | Q9H0P0 |
| Refseq Size | 1846 |
| Cytogenetics | 7p14.3 |
| Refseq ORF | 891 |
| Synonyms | cN-III; hUMP1; NT5C3; P5'N-1; P5N-1; p36; PN-I; POMP; PSN1; UMPH; UMPH1 |
| Summary | This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. Mutations in this gene are a cause of hemolytic anemia due to uridine 5-prime monophosphate hydrolase deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and pseudogenes of this gene are located on the long arm of chromosomes 3 and 4. [provided by RefSeq, Mar 2012] |
| Protein Families | Transmembrane |
| Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413931 | NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424318 | NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424319 | NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413931 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3 |
CNY 3,080.00 |
|
| LY424318 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2 |
CNY 3,080.00 |
|
| LY424319 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1 |
CNY 3,080.00 |
|
| PH305629 | NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_057573) |
CNY 19,520.00 |
|
| PH309741 | NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_001002009) |
CNY 19,520.00 |
|
| TP309741 | Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, 20 µg |
CNY 2,900.00 |
