Rab9 (RAB9A) (NM_004251) Human Recombinant Protein
CAT#: TP305698
Recombinant protein of human RAB9A, member RAS oncogene family (RAB9A), 20 µg
View other "Rab9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205698 protein sequence
Red=Cloning site Green=Tags(s) MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFR SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQA WCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSCC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004242 |
Locus ID | 9367 |
UniProt ID | P51151, A0A024RBV5 |
Refseq Size | 1377 |
Cytogenetics | Xp22.2 |
Refseq ORF | 603 |
Synonyms | RAB9 |
Summary | Involved in the transport of proteins between the endosomes and the trans Golgi network. Involved in the recruitment of SGSM2 to melanosomes and is required for the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
An alternative mitophagy pathway mediated by Rab9 protects the heart against ischemia
,null,
The Journal of Clinical Investigation
,PubMed ID 30511961
[RAB9A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401363 | RAB9A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401363 | Transient overexpression lysate of RAB9A, member RAS oncogene family (RAB9A) |
CNY 3,080.00 |
|
PH305698 | RAB9A MS Standard C13 and N15-labeled recombinant protein (NP_004242) |
CNY 19,520.00 |