CALML3 (NM_005185) Human Recombinant Protein
CAT#: TP305791L
Recombinant protein of human calmodulin-like 3 (CALML3), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205791 protein sequence
Red=Cloning site Green=Tags(s) MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFL GMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYE EFVRVLVSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005176 |
Locus ID | 810 |
UniProt ID | P27482 |
Refseq Size | 1417 |
Cytogenetics | 10p15.1 |
Refseq ORF | 447 |
Synonyms | CLP |
Summary | May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Alzheimer's disease, Calcium signaling pathway, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Phosphatidylinositol signaling system, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |