CYB5R1 (NM_016243) Human Recombinant Protein
CAT#: TP305833
Recombinant protein of human cytochrome b5 reductase 1 (CYB5R1), 20 µg
View other "CYB5R1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205833 protein sequence
Red=Cloning site Green=Tags(s) MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPT AHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKV GDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFL LFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGP PPMVQLACHPNLDKLGYSQKMRFTY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057327 |
Locus ID | 51706 |
UniProt ID | Q9UHQ9 |
Refseq Size | 1675 |
Cytogenetics | 1q32.1 |
Refseq ORF | 915 |
Synonyms | B5R.1; B5R1; B5R2; humb5R2; NQO3A2 |
Summary | NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Amino sugar and nucleotide sugar metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402525 | CYB5R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402525 | Transient overexpression lysate of cytochrome b5 reductase 1 (CYB5R1) |
CNY 3,080.00 |
|
PH305833 | CYB5R1 MS Standard C13 and N15-labeled recombinant protein (NP_057327) |
CNY 19,520.00 |