FRS2 (NM_006654) Human Recombinant Protein
CAT#: TP305842
Recombinant protein of human fibroblast growth factor receptor substrate 2 (FRS2), transcript variant 1, 20 µg
View other "FRS2" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205842 protein sequence
Red=Cloning site Green=Tags(s) MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSN LFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTPTTPG FAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRT SVHVPLEARVSNAESSTPKEEPSSIEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSG ANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYE NLPSLPPVWEARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALP RDDGTSRKTRHNSTDLPMLAWK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006645 |
Locus ID | 10818 |
UniProt ID | Q8WU20 |
Refseq Size | 6883 |
Cytogenetics | 12q15 |
Refseq ORF | 1536 |
Synonyms | FRS1A; FRS2A; FRS2alpha; SNT; SNT-1; SNT1 |
Summary | Adapter protein that links activated FGR and NGF receptors to downstream signaling pathways. Plays an important role in the activation of MAP kinases and in the phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, in response to ligand-mediated activation of FGFR1. Modulates signaling via SHC1 by competing for a common binding site on NTRK1.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Neurotrophin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401989 | FRS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420983 | FRS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC425774 | FRS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401989 | Transient overexpression lysate of fibroblast growth factor receptor substrate 2 (FRS2), transcript variant 1 |
CNY 3,080.00 |
|
LY420983 | Transient overexpression lysate of fibroblast growth factor receptor substrate 2 (FRS2), transcript variant 2 |
CNY 4,840.00 |
|
PH305842 | FRS2 MS Standard C13 and N15-labeled recombinant protein (NP_006645) |
CNY 19,520.00 |