IFI30 (NM_006332) Human Recombinant Protein
CAT#: TP305877
Purified recombinant protein of Homo sapiens interferon, gamma-inducible protein 30 (IFI30), 20 µg
View other "IFI30" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205877 protein sequence
Red=Cloning site Green=Tags(s) MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEA LCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDME LAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTV NGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006323 |
Locus ID | 10437 |
UniProt ID | P13284, A0A024R7N7 |
Refseq Size | 1034 |
Cytogenetics | 19p13.11 |
Refseq ORF | 750 |
Synonyms | GILT; IFI-30; IP-30; IP30 |
Summary | The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. [provided by RefSeq, Jul 2008] |
Protein Pathways | Antigen processing and presentation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416719 | IFI30 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416719 | Transient overexpression lysate of interferon, gamma-inducible protein 30 (IFI30) |
CNY 3,080.00 |
|
PH305877 | IFI30 MS Standard C13 and N15-labeled recombinant protein (NP_006323) |
CNY 14,250.00 |