Cyclophilin 40 (PPID) (NM_005038) Human Recombinant Protein
CAT#: TP306039
Recombinant protein of human peptidylprolyl isomerase D (PPID), 20 µg
View other "Cyclophilin 40" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206039 protein sequence
Red=Cloning site Green=Tags(s) MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKG CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTP HLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDAD IDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKV KQKIKAQKDKEKAVYAKMFA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005029 |
Locus ID | 5481 |
UniProt ID | Q08752, E5KN55 |
Refseq Size | 1851 |
Cytogenetics | 4q32.1 |
Refseq ORF | 1110 |
Synonyms | CYP-40; CYPD |
Summary | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Calcium signaling pathway, Huntington's disease, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401561 | PPID HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401561 | Transient overexpression lysate of peptidylprolyl isomerase D (PPID) |
CNY 3,080.00 |
|
PH306039 | PPID MS Standard C13 and N15-labeled recombinant protein (NP_005029) |
CNY 19,520.00 |
|
TP720861 | Purified recombinant protein of Human peptidylprolyl isomerase D (PPID) |
CNY 3,140.00 |
其它Cyclophilin 40产品