EGLN2 (NM_053046) Human Recombinant Protein
CAT#: TP306152
Recombinant protein of human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1, 20 µg
View other "EGLN2" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206152 protein sequence
Red=Cloning site Green=Tags(s) MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATS TTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQE NQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEV EALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRT KAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIF WSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Enzyme activity (In vitro hydroxylation assay) (PMID: 26751287) |
Reference Data | |
RefSeq | NP_444274 |
Locus ID | 112398 |
UniProt ID | Q96KS0 |
Refseq Size | 2264 |
Cytogenetics | 19q13.2 |
Refseq ORF | 1221 |
Synonyms | EIT-6; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1 |
Summary | The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Pathways in cancer, Renal cell carcinoma |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Proline Hydroxylation Primes Protein Kinases for Autophosphorylation and Activation
,Lee, SB;Ko, A;Oh, YT;Shi, P;D'Angelo, F;Frangaj, B;Koller, A;Chen, EI;Cardozo, T;Iavarone, A;Lasorella, A;,
Mol. Cell
,PubMed ID 32640193
[EGLN2]
|
The LINK-A lncRNA activates normoxic HIF1 [alpha] signalling in triple-negative breast cancer
,Lin, A;Li, C;Xing, Z;Hu, Q;Liang, K;Han, L;Wang, C;,
Nature cell biology
,PubMed ID 26751287
[EGLN2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403281 | EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409048 | EGLN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403281 | Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 1 |
CNY 3,080.00 |
|
LY409048 | Transient overexpression lysate of egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3 |
CNY 3,080.00 |
|
PH306152 | EGLN2 MS Standard C13 and N15-labeled recombinant protein (NP_444274) |
CNY 19,520.00 |
|
TP760370 | Purified recombinant protein of Human egl nine homolog 2 (C. elegans) (EGLN2), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |