RHOBTB1 (NM_014836) Human Recombinant Protein
CAT#: TP306310
Recombinant protein of human Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 1, 20 µg
View other "RHOBTB1" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206310 protein sequence
Red=Cloning site Green=Tags(s) MDADMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYRVCQEVLERSR DVVDEVSVSLRLWDTFGDHHKDRRFAYGRSDVVVLCFSIANPNSLNHVKSMWYPEIKHFCPRTPVILVGC QLDLRYADLEAVNRARRPLARPIKRGDILPPEKGREVAKELGLPYYETSVFDQFGIKDVFDNAIRAALIS RRHLQFWKSHLKKVQKPLLQAPFLPPKAPPPVIKIPECPSMGTNEAACLLDNPLCADVLFILQDQEHIFA HRIYLATSSSKFYDLFLMECEESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSN KSLVEALGLEAEGAVPETQTLTGWSKGFIGMHREMQVNPISKRMGPMTVVRMDASVQPGPFRTLLQFLYT GQLDEKEKDLVGLAQIAEVLEMFDLRMMVENIMNKEAFMNQEITKAFHVRKANRIKECLSKGTFSDVTFK LDDGAISAHKPLLICSCEWMAAMFGGSFVESANSEVYLPNINKISMQAVLDYLYTKQLSPNLDLDPLELI ALANRFCLPHLVALAEQHAVQELTKAATSGVGIDGEVLSYLELAQFHNAHQLAAWCLHHICTNYNSVCSK FRKEIKSKSADNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWNSSPAVA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 79.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055651 |
Locus ID | 9886 |
UniProt ID | O94844 |
Refseq Size | 4515 |
Cytogenetics | 10q21.2 |
Refseq ORF | 2088 |
Summary | The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Dec 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404953 | RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC414991 | RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422316 | RHOBTB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY404953 | Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 2 |
CNY 4,840.00 |
|
LY414991 | Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 1 |
CNY 3,080.00 |
|
LY422316 | Transient overexpression lysate of Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 3 |
CNY 4,840.00 |
|
PH306310 | RHOBTB1 MS Standard C13 and N15-labeled recombinant protein (NP_055651) |
CNY 19,520.00 |
|
TP761967 | Purified recombinant protein of Human Rho-related BTB domain containing 1 (RHOBTB1), transcript variant 3,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,050.00 |
其它RHOBTB1产品