Myozenin 1 (MYOZ1) (NM_021245) Human Recombinant Protein
CAT#: TP306448
Recombinant protein of human myozenin 1 (MYOZ1), 20 µg
View other "Myozenin 1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206448 protein sequence
Red=Cloning site Green=Tags(s) MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKF IYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSG AGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYG AKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGE PVDYNVDIGIPLDGETEEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067068 |
Locus ID | 58529 |
UniProt ID | Q9NP98 |
Refseq Size | 1583 |
Cytogenetics | 10q22.2 |
Refseq ORF | 897 |
Synonyms | CS-2; FATZ; MYOZ |
Summary | The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411997 | MYOZ1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411997 | Transient overexpression lysate of myozenin 1 (MYOZ1) |
CNY 3,080.00 |
|
PH306448 | MYOZ1 MS Standard C13 and N15-labeled recombinant protein (NP_067068) |
CNY 19,520.00 |
|
TP761507 | Purified recombinant protein of Human myozenin 1 (MYOZ1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Myozenin 1产品