ALKBH1 (NM_006020) Human Recombinant Protein
CAT#: TP306529
Recombinant protein of human alkB, alkylation repair homolog 1 (E. coli) (ALKBH1), 20 µg
View other "ALKBH1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206529 protein sequence
Red=Cloning site Green=Tags(s) MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVS SVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEET QDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFE DFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSG FSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006011 |
Locus ID | 8846 |
UniProt ID | Q13686 |
Refseq Size | 2585 |
Cytogenetics | 14q24.3 |
Refseq ORF | 1167 |
Synonyms | ABH; ABH1; alkB; ALKBH; hABH |
Summary | This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
N6-methyladenine DNA Modification in Glioblastoma
,Xie, Q;Wu, TP;Gimple, RC;Li, Z;Prager, BC;Wu, Q;Yu, Y;Wang, P;Wang, Y;Gorkin, DU;Zhang, C;Dowiak, AV;Lin, K;Zeng, C;Sui, Y;Kim, LJY;Miller, TE;Jiang, L;Lee, CH;Huang, Z;Fang, X;Zhai, K;Mack, SC;Sander, M;Bao, S;Kerstetter-Fogle, AE;Sloan, AE;Xiao, AZ;Rich, JN;,
Cell
,PubMed ID 30392959
[ALKBH1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401825 | ALKBH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401825 | Transient overexpression lysate of alkB, alkylation repair homolog 1 (E. coli) (ALKBH1) |
CNY 3,080.00 |
|
PH306529 | ALKBH1 MS Standard C13 and N15-labeled recombinant protein (NP_006011) |
CNY 19,520.00 |