CD2 (NM_001767) Human Recombinant Protein
CAT#: TP306612
Purified recombinant protein of Homo sapiens CD2 molecule (CD2), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206612 protein sequence
Red=Cloning site Green=Tags(s) MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQ FRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCI NTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDI YLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPQQIPASTPQNPATSQ HPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSS N myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001758 |
Locus ID | 914 |
UniProt ID | P06729, Q53F96 |
Refseq Size | 1595 |
Cytogenetics | 1p13.1 |
Refseq ORF | 1053 |
Synonyms | LFA-2; SRBC; T11 |
Summary | The protein encoded by this gene is a surface antigen found on all peripheral blood T-cells. The encoded protein interacts with LFA3 (CD58) on antigen presenting cells to optimize immune recognition. A locus control region (LCR) has been found in the 3' flanking sequence of this gene. [provided by RefSeq, Jun 2016] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Hematopoietic cell lineage |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400671 | CD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400671 | Transient overexpression lysate of CD2 molecule (CD2) |
CNY 3,080.00 |
|
PH306612 | CD2 MS Standard C13 and N15-labeled recombinant protein (NP_001758) |
CNY 14,250.00 |
|
TP700239 | Purified recombinant protein of human CD2 molecule (CD2), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP721123 | Purified recombinant protein of Human CD2 molecule (CD2) |
CNY 5,460.00 |
|
TP761130 | Purified recombinant protein of Human CD2 molecule (CD2), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |