RAI2 (NM_021785) Human Recombinant Protein
CAT#: TP306638
Recombinant protein of human retinoic acid induced 2 (RAI2), 20 µg
View other "RAI2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206638 protein sequence
Red=Cloning site Green=Tags(s) MDDLQSQNLSMDMTDSPPALANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMA LKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNATYVMTTQGPVQLPVVLEQHVFQHLNSPLVL PQEAPCSSSTIHNNLFQGAEDPEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPSQGTLGPPPCQPPPGYA PVPPQPFSSPLSPLVPPATLLVPYPVIVPLPVPVPIPIPIPVPQSSESKFSSSFPKPPSSFGLHPFKGTQ TPLEKDELKPFDILQPKEYFQLSRHTVIKMGSENEALDLSMKSVPWLKAGEVSPPIFQEDAPLDLSVAAH RKSEPPPETLYDSGASVDSSGHTVMEKLPSGMEISFAPATSHEAPAMMDSHISSSDAATEMLSQPNHPSG EVKAENNIEMVGESQAAKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEESMGN AEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_068557 |
Locus ID | 10742 |
UniProt ID | Q9Y5P3, A0A024RBZ8, B3KPD7, B2RBE9 |
Refseq Size | 2229 |
Cytogenetics | Xp22.13 |
Refseq ORF | 1590 |
Summary | Retinoic acid plays a critical role in development, cellular growth, and differentiation. The specific function of this retinoic acid-induced gene has not yet been determined but it may play a role in development. The chromosomal location of this gene designates it to be a candidate for diseases such as Nance-Horan syndrome, sensorineural deafness, non-specific X-linked cognitive disability, oral-facial-digital syndrome, and Fried syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411926 | RAI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433148 | RAI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433236 | RAI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411926 | Transient overexpression lysate of retinoic acid induced 2 (RAI2) |
CNY 3,080.00 |
|
LY433148 | Transient overexpression lysate of retinoic acid induced 2 (RAI2), transcript variant 4 |
CNY 3,080.00 |
|
LY433236 | Transient overexpression lysate of retinoic acid induced 2 (RAI2), transcript variant 1 |
CNY 3,080.00 |
|
PH306638 | RAI2 MS Standard C13 and N15-labeled recombinant protein (NP_068557) |
CNY 19,520.00 |