United States
Germany
Japan
United Kingdom
China
ATP6V1H (NM_015941) Human Recombinant Protein
CAT＃: TP306841
Recombinant protein of human ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H (ATP6V1H), transcript variant 1, 20 µg
View other "ATP6V1H" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 6,281.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206841 protein sequence
Red=Cloning site Green=Tags(s) MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEG SQCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNRQDPFTVHM AARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLR VNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEK VTRIILAAFRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLS SFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAAARS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057025 |
| Locus ID | 51606 |
| UniProt ID | Q9UI12 |
| Refseq Size | 2186 |
| Cytogenetics | 8q11.23 |
| Refseq ORF | 1449 |
| Synonyms | CGI-11; MSTP042; NBP1; SFD; SFDalpha; SFDbeta; VMA13 |
| Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular organelles. V-ATPase-dependent organelle acidification is necessary for multiple processes including protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. The encoded protein is the regulatory H subunit of the V1 domain of V-ATPase, which is required for catalysis of ATP but not the assembly of V-ATPase. Decreased expression of this gene may play a role in the development of type 2 diabetes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012] |
| Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403891 | ATP6V1H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC403892 | ATP6V1H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC414295 | ATP6V1H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431017 | ATP6V1H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403891 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H (ATP6V1H), transcript variant 2 |
CNY 4,840.00 |
|
| LY403892 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H (ATP6V1H), transcript variant 3 |
CNY 4,840.00 |
|
| LY414295 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H (ATP6V1H), transcript variant 1 |
CNY 3,080.00 |
|
| PH306841 | ATP6V1H MS Standard C13 and N15-labeled recombinant protein (NP_057025) |
CNY 19,520.00 |
其它ATP6V1H产品
