MKRN1 (NM_013446) Human Recombinant Protein
CAT#: TP306848
Recombinant protein of human makorin ring finger protein 1 (MKRN1), transcript variant 1, 20 µg
View other "MKRN1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206848 representing NM_013446
Red=Cloning site Green=Tags(s) MAEAATPGTTATTSGAGAAAATAAAASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCK EGDNCRYSHDLSDSPYSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGP LVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEAPLQGSVTKEESEKEQTAVETK KQLCPYAAVGECRYGENCVYLHGDSCDMCGLQLLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMV CGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEE KEEKQKLILKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW ELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDLDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_038474 |
Locus ID | 23608 |
UniProt ID | Q9UHC7 |
Refseq Size | 3116 |
Cytogenetics | 7q34 |
Refseq ORF | 1446 |
Synonyms | RNF61 |
Summary | This gene encodes a protein that belongs to a novel class of zinc finger proteins. The encoded protein functions as a transcriptional co-regulator, and as an E3 ubiquitin ligase that promotes the ubiquitination and proteasomal degradation of target proteins. The protein encoded by this gene is thought to regulate RNA polymerase II-catalyzed transcription. Substrates for this protein's E3 ubiquitin ligase activity include the capsid protein of the West Nile virus and the catalytic subunit of the telomerase ribonucleoprotein. This protein controls cell cycle arrest and apoptosis by regulating p21, a cell cycle regulator, and the tumor suppressor protein p53. Pseudogenes of this gene are present on chromosomes 1, 3, 9, 12 and 20, and on the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415580 | MKRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428707 | MKRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415580 | Transient overexpression lysate of makorin ring finger protein 1 (MKRN1), transcript variant 1 |
CNY 3,080.00 |
|
LY428707 | Transient overexpression lysate of makorin ring finger protein 1 (MKRN1), transcript variant 2 |
CNY 3,080.00 |
|
PH306848 | MKRN1 MS Standard C13 and N15-labeled recombinant protein (NP_038474) |
CNY 19,520.00 |