CD93 (NM_012072) Human Recombinant Protein
CAT#: TP306980
Recombinant protein of human CD93 molecule (CD93), 20 µg
View other "CD93" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206980 protein sequence
Red=Cloning site Green=Tags(s) MATSMGLLLLLLLLLTQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQ HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR CVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSS SLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGD GSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQ DSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGE DGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKE GSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQE PAGGDSSVATQNNDGTDGQKLLLFYILGTVVAILLLLALALGLLVYRKRRAKREEKKEKKPQNAADSYSW VPERAESRAMENQYSPTPGTDC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 66.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036204 |
Locus ID | 22918 |
UniProt ID | Q9NPY3 |
Refseq Size | 6701 |
Cytogenetics | 20p11.21 |
Refseq ORF | 1956 |
Synonyms | C1qR(P); C1QR1; C1qRP; CDw93; dJ737E23.1; ECSM3; MXRA4 |
Summary | The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Unique properties of cluster of differentiation 93 in the umbilical cord blood of neonates.
,null,
Microbiology and immunology
,PubMed ID 24033555
[CD93]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415997 | CD93 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415997 | Transient overexpression lysate of CD93 molecule (CD93) |
CNY 3,080.00 |
|
PH306980 | CD93 MS Standard C13 and N15-labeled recombinant protein (NP_036204) |
CNY 19,520.00 |
|
TP720347 | Recombinant protein of human CD93 molecule (CD93) |
CNY 3,140.00 |