MTLRP (GHRL) (NM_016362) Human Recombinant Protein
CAT#: TP306989
Purified recombinant protein of Homo sapiens ghrelin/obestatin prepropeptide (GHRL), transcript variant 1, 20 µg
View other "MTLRP" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206989 protein sequence
Red=Cloning site Green=Tags(s) MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAED EMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057446 |
Locus ID | 51738 |
UniProt ID | Q9UBU3 |
Refseq Size | 552 |
Cytogenetics | 3p25.3 |
Refseq ORF | 351 |
Synonyms | MTLRP |
Summary | This gene encodes the ghrelin-obestatin preproprotein that is cleaved to yield two peptides, ghrelin and obestatin. Ghrelin is a powerful appetite stimulant and plays an important role in energy homeostasis. Its secretion is initiated when the stomach is empty, whereupon it binds to the growth hormone secretagogue receptor in the hypothalamus which results in the secretion of growth hormone (somatotropin). Ghrelin is thought to regulate multiple activities, including hunger, reward perception via the mesolimbic pathway, gastric acid secretion, gastrointestinal motility, and pancreatic glucose-stimulated insulin secretion. It was initially proposed that obestatin plays an opposing role to ghrelin by promoting satiety and thus decreasing food intake, but this action is still debated. Recent reports suggest multiple metabolic roles for obestatin, including regulating adipocyte function and glucose metabolism. Alternative splicing results in multiple transcript variants. In addition, antisense transcripts for this gene have been identified and may potentially regulate ghrelin-obestatin preproprotein expression. [provided by RefSeq, Nov 2014] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402547 | GHRL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402547 | Transient overexpression lysate of ghrelin/obestatin prepropeptide (GHRL), transcript variant 1 |
CNY 3,080.00 |
|
PH306989 | GHRL MS Standard C13 and N15-labeled recombinant protein (NP_057446) |
CNY 14,250.00 |