TSSK2 (NM_053006) Human Recombinant Protein
CAT#: TP307232M
Recombinant protein of human testis-specific serine kinase 2 (TSSK2), 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207232 protein sequence
Red=Cloning site Green=Tags(s) MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHG SIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCE NLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYDIWSLGVILYIMV CGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQRLHIDEILSHSWLQPPKPKAT SSASFKREGEGKYRAECKLDTKTDLRPDHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISG AEVGKAST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | TSSK2 activity verified in a biochemical assay: TSSK2 (testis-specific serine kinase 2) (TP307232) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. TSSK2 is a serine/threonine kinase that is highly expressed in testis and may be involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. Varying concentrations of TSSK2 were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Reference Data | |
RefSeq | NP_443732 |
Locus ID | 23617 |
UniProt ID | Q96PF2, A0ZT99 |
Refseq Size | 1832 |
Cytogenetics | 22q11.21 |
Refseq ORF | 1074 |
Synonyms | DGS-G; SPOGA2; STK22B; TSK2 |
Summary | TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |