LYRIC (MTDH) (NM_178812) Human Recombinant Protein
CAT#: TP307238
Recombinant protein of human metadherin (MTDH), 20 µg
View other "LYRIC" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207238 protein sequence
Red=Cloning site Green=Tags(s) MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYG WAAACAGSRKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEA VRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKV LTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLT VNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKAEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIG STAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIP DDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSL KTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQT KSETSWESPKQIKKKKKARRET myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Surface Plasmon Ressonance (SPR) (PMID: 26149384) |
Reference Data | |
RefSeq | NP_848927 |
Locus ID | 92140 |
UniProt ID | Q86UE4, A0A024R9D2 |
Refseq Size | 7667 |
Cytogenetics | 8q22.1 |
Refseq ORF | 1746 |
Synonyms | 3D3; AEG-1; AEG1; LYRIC; LYRIC/3D3 |
Summary | Downregulates SLC1A2/EAAT2 promoter activity when expressed ectopically. Activates the nuclear factor kappa-B (NF-kappa-B) transcription factor. Promotes anchorage-independent growth of immortalized melanocytes and astrocytes which is a key component in tumor cell expansion. Promotes lung metastasis and also has an effect on bone and brain metastasis, possibly by enhancing the seeding of tumor cells to the target organ endothelium. Induces chemoresistance.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Ezrin binds to DEAD-box RNA helicase DDX3 and regulates its function and protein level
,Çelik, H;Sajwan, KP;Selvanathan, SP;Marsh, BJ;Pai, AV;Saygideger Kont, Y;Han, J;Minas, TZ;Rahim, S;Erkizan, HV;Toretsky, JA;Üren, A;,
Mol. Cell. Biol.
,PubMed ID 26149384
[MTDH]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403614 | MTDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403614 | Transient overexpression lysate of metadherin (MTDH) |
CNY 3,080.00 |
|
PH307238 | MTDH MS Standard C13 and N15-labeled recombinant protein (NP_848927) |
CNY 19,520.00 |
|
TP710116 | Recombinant protein of human metadherin (MTDH), residues 70-582aa, with N-terminal His tag,expressed in sf9 cells |
CNY 4,020.00 |