PPIL6 (NM_173672) Human Recombinant Protein
CAT#: TP307244
Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 6 (PPIL6), transcript variant 1, 20 µg
View other "PPIL6" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207244 protein sequence
Red=Cloning site Green=Tags(s) MARPQPCGPPHARCGSPSLPERPLQVKVVGLFSCPNFQIAKSAAENLKNNHPSKFEDPILVPLQEFAWHQ YLQEKKRELKNETWEYSSSVISFVNGQFLGDALDLQKWAHEVWDIVDIKPSALYDALTEDFSAKFLRDTK HDFVFLDICIDSSPIGRLIFELYCDVCPKTCKNFQVLCTGKAGFSQRGIRLHYKNSIFHRIVQNGWIQGG DIVYGKGDNGESIYGPTFEDENFSVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEG TEVLKQLELVPTQNERPIHMCRITDSGDPYA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_775943 |
Locus ID | 285755 |
UniProt ID | Q8IXY8 |
Refseq Size | 4145 |
Cytogenetics | 6q21 |
Refseq ORF | 933 |
Synonyms | bA425D10.6; dJ919F19.1; PPIase; RSPH12 |
Summary | Probable inactive PPIase with no peptidyl-prolyl cis-trans isomerase activity.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406551 | PPIL6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426361 | PPIL6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406551 | Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 6 (PPIL6), transcript variant 1 |
CNY 3,080.00 |
|
LY426361 | Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 6 (PPIL6), transcript variant 2 |
CNY 3,080.00 |
|
PH307244 | PPIL6 MS Standard C13 and N15-labeled recombinant protein (NP_775943) |
CNY 19,520.00 |