BID (NM_001196) Human Recombinant Protein
CAT#: TP307261
Recombinant protein of human BH3 interacting domain death agonist (BID), transcript variant 2, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207261 protein sequence
Red=Cloning site Green=Tags(s) MCSGAGVMMARWAARGRAGWRSTVRILSPLGHCEPGVSRSCRAAQAMDCEVNNGSSLRDECITNLLVFGF LQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVG DSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASQTP SLLRDVFHTTVNFINQNLRTYVRSLARNGMD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001187 |
Locus ID | 637 |
UniProt ID | P55957 |
Refseq Size | 2217 |
Cytogenetics | 22q11.21 |
Refseq ORF | 726 |
Synonyms | FP497 |
Summary | This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2, and thus regulate apoptosis. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Pathways in cancer, Viral myocarditis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405092 | BID HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420074 | BID HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405092 | Transient overexpression lysate of BH3 interacting domain death agonist (BID), transcript variant 3 |
CNY 3,080.00 |
|
LY420074 | Transient overexpression lysate of BH3 interacting domain death agonist (BID), transcript variant 2 |
CNY 3,080.00 |
|
PH307261 | BID MS Standard C13 and N15-labeled recombinant protein (NP_001187) |
CNY 19,520.00 |
|
TP720087 | Recombinant protein of human BH3 interacting domain death agonist (BID), transcript variant 2 |
CNY 1,800.00 |
|
TP760319 | Recombinant protein of human BH3 interacting domain death agonist (BID), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |