Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein

CAT#: TP307428M

Recombinant protein of human glutathione peroxidase 7 (GPX7), 100 µg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 9,998.00


货期*
4周

规格
    • 100 ug

Product images

经常一起买 (3)
Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)
    • 100 ul

CNY 6,281.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC207428 protein sequence
Red=Cloning site Green=Tags(s)

MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQL
QRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEP
TWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_056511
Locus ID 2882
UniProt ID Q96SL4
Refseq Size 1246
Cytogenetics 1p32.3
Refseq ORF 561
Synonyms CL683; GPx-7; GPX6; GSHPx-7; NPGPx
Summary It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Arachidonic acid metabolism, Glutathione metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

You may also need
Customer Reviews 
Loading...