Calcyon (CALY) (NM_015722) Human Recombinant Protein
CAT#: TP307894
Recombinant protein of human calcyon neuron-specific vesicular protein (CALY), 20 µg
View other "Calcyon" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207894 protein sequence
Red=Cloning site Green=Tags(s) MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQ RLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPER HRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGS AAPPPAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056537 |
Locus ID | 50632 |
UniProt ID | Q9NYX4 |
Refseq Size | 983 |
Cytogenetics | 10q26.3 |
Refseq ORF | 651 |
Synonyms | DRD1IP; NSG3 |
Summary | The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414354 | CALY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414354 | Transient overexpression lysate of calcyon neuron-specific vesicular protein (CALY) |
CNY 3,080.00 |
|
PH307894 | CALY MS Standard C13 and N15-labeled recombinant protein (NP_056537) |
CNY 14,250.00 |
其它Calcyon产品