PFD6 (PFDN6) (NM_014260) Human Recombinant Protein
CAT#: TP307901
Recombinant protein of human prefoldin subunit 6 (PFDN6), 20 µg
View other "PFD6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207901 protein sequence
Red=Cloning site Green=Tags(s) MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG EARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055075 |
Locus ID | 10471 |
UniProt ID | O15212, Q5STK2 |
Refseq Size | 602 |
Cytogenetics | 6p21.32 |
Refseq ORF | 387 |
Synonyms | H2-KE2; HKE2; KE-2; PFD6 |
Summary | PFDN6 is a subunit of the heteromeric prefoldin complex that chaperones nascent actin (see MIM 102560) and alpha- and beta-tubulin (see MIM 602529 and MIM 191130, respectively) chains pending their transfer to the cytosolic chaperonin containing TCP1 (MIM 186980) (CCT) complex (Hansen et al., 1999 [PubMed 10209023]).[supplied by OMIM, Jul 2010] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415391 | PFDN6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415391 | Transient overexpression lysate of prefoldin subunit 6 (PFDN6) |
CNY 3,080.00 |
|
PH307901 | PFDN6 MS Standard C13 and N15-labeled recombinant protein (NP_055075) |
CNY 19,520.00 |