PCYT1A (NM_005017) Human Recombinant Protein
CAT#: TP308130
Recombinant protein of human phosphate cytidylyltransferase 1, choline, alpha (PCYT1A), 20 µg
View other "PCYT1A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208130 representing NM_005017
Red=Cloning site Green=Tags(s) MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRG TPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCR YVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIV RDYDVYARRNLQRGYTAKELNVSFINEKKYHLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEE KSREFIGSFLEMFGPEGALKHMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPAN LSRHKAAAYDISEDEED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005008 |
Locus ID | 5130 |
UniProt ID | P49585 |
Refseq Size | 1677 |
Cytogenetics | 3q29 |
Refseq ORF | 1101 |
Synonyms | CCTA; CCTalpha; CT; CTA; CTPCT; PCYT1; SMDCRD |
Summary | This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2015] |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417575 | PCYT1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417575 | Transient overexpression lysate of phosphate cytidylyltransferase 1, choline, alpha (PCYT1A) |
CNY 3,080.00 |
|
PH308130 | PCYT1A MS Standard C13 and N15-labeled recombinant protein (NP_005008) |
CNY 19,520.00 |