NOXA1 (NM_006647) Human Recombinant Protein
CAT#: TP308357
Recombinant protein of human NADPH oxidase activator 1 (NOXA1), 20 µg
View other "NOXA1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208357 protein sequence
Red=Cloning site Green=Tags(s) MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDPEAALRAFDQAVTKDTC MAVGFFQRGVANFQLARFQEALSDFWLALEQLRGHAAIDYTQLGLRFKLQAWEVLHNVASAQCQLGLWTE AASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAI PDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAP LSPGLPAMGGPGPGPCEDPAGAGGAGAGGSEPLVTVTVQCAFTVALRARRGADLSSLRALLGQALPHQAQ LGQLSYLAPGEDGHWVPIPEEESLQRAWQDAAACPRGLQLQCRGAGGRPVLYQVVAQHSYSAQGPEDLGF RQGDTVDVLCEEPDVPLAVDQAWLEGHCDGRIGIFPKCFVVPAGPRMSGAPGRLPRSQQGDQP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006638 |
Locus ID | 10811 |
UniProt ID | Q86UR1 |
Refseq Size | 1650 |
Cytogenetics | 9q34.3 |
Refseq ORF | 1449 |
Synonyms | NY-CO-31; p51NOX; SDCCAG31 |
Summary | This gene encodes a protein which activates NADPH oxidases, enzymes which catalyze a reaction generating reactive oxygen species. The encoded protein contains four N-terminal tetratricopeptide domains and a C-terminal Src homology 3 domain. Interaction between the encoded protein and proteins in the oxidase regulatory complex occur via the tetratricopeptide domains. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
CHIP ubiquitylates NOXA and induces its lysosomal degradation in response to DNA damage
,Albert, MC;Brinkmann, K;Pokrzywa, W;Günther, SD;Krönke, M;Hoppe, T;Kashkar, H;,
Cell death & disease
,PubMed ID 32913203
[NOXA1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416502 | NOXA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416502 | Transient overexpression lysate of NADPH oxidase activator 1 (NOXA1) |
CNY 3,080.00 |
|
PH308357 | NOXA1 MS Standard C13 and N15-labeled recombinant protein (NP_006638) |
CNY 19,520.00 |