Arp3 (ACTR3) (NM_005721) Human Recombinant Protein
CAT#: TP308460
Recombinant protein of human ARP3 actin-related protein 3 homolog (yeast) (ACTR3), 20 µg
View other "Arp3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208460 protein sequence
Red=Cloning site Green=Tags(s) MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKP TYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLY IAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRD REVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPE IFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLS EELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005712 |
Locus ID | 10096 |
UniProt ID | P61158 |
Refseq Size | 5708 |
Cytogenetics | 2q14.1 |
Refseq ORF | 1254 |
Synonyms | ARP3 |
Summary | The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Mar 2013] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
WASp modulates RPA function on single-stranded DNA in response to replication stress and DNA damage
,null,
Nature Communications
,PubMed ID 35768435
[ACTR3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417113 | ACTR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417113 | Transient overexpression lysate of ARP3 actin-related protein 3 homolog (yeast) (ACTR3) |
CNY 3,080.00 |
|
PH308460 | ACTR3 MS Standard C13 and N15-labeled recombinant protein (NP_005712) |
CNY 19,520.00 |