Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein
CAT#: TP308964
Recombinant protein of human Shwachman-Bodian-Diamond syndrome (SBDS), 20 µg
View other "Shwachman Bodian Diamond syndrome" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208964 protein sequence
Red=Cloning site Green=Tags(s) MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKED LISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDI HYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVC LIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057122 |
Locus ID | 51119 |
UniProt ID | Q9Y3A5, A0A0S2Z5I7 |
Refseq Size | 1605 |
Cytogenetics | 7q11.21 |
Refseq ORF | 750 |
Synonyms | CGI-97; SDO1; SDS; SWDS |
Summary | This gene encodes a highly conserved protein that plays an essential role in ribosome biogenesis. The encoded protein interacts with elongation factor-like GTPase 1 to disassociate eukaryotic initiation factor 6 from the late cytoplasmic pre-60S ribosomal subunit allowing assembly of the 80S subunit. Mutations within this gene are associated with the autosomal recessive disorder Shwachman-Bodian-Diamond syndrome. This gene has a closely linked pseudogene that is distally located. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414234 | SBDS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414234 | Transient overexpression lysate of Shwachman-Bodian-Diamond syndrome (SBDS) |
CNY 3,080.00 |
|
PH308964 | SBDS MS Standard C13 and N15-labeled recombinant protein (NP_057122) |
CNY 19,520.00 |
其它Shwachman Bodian Diamond syndrome产品