GNAQ (NM_002072) Human Recombinant Protein
CAT#: TP309199
Recombinant protein of human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 20 µg
View other "GNAQ" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209199 protein sequence
Red=Cloning site Green=Tags(s) MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDE DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPG IQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQR SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE EKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ LNLKEYNLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002063 |
Locus ID | 2776 |
UniProt ID | P50148 |
Refseq Size | 6343 |
Cytogenetics | 9q21.2 |
Refseq ORF | 1077 |
Synonyms | CMC1; G-ALPHA-q; GAQ; SWS |
Summary | This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Calcium signaling pathway, Gap junction, GnRH signaling pathway, Huntington's disease, Long-term depression, Long-term potentiation, Melanogenesis, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400763 | GNAQ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400763 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), q polypeptide (GNAQ) |
CNY 3,080.00 |
|
PH309199 | GNAQ MS Standard C13 and N15-labeled recombinant protein (NP_002063) |
CNY 19,520.00 |