SNAP-beta (NAPB) (NM_022080) Human Recombinant Protein
CAT#: TP309278
Recombinant protein of human N-ethylmaleimide-sensitive factor attachment protein, beta (NAPB), 20 µg
View other "SNAP-beta" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209278 protein sequence
Red=Cloning site Green=Tags(s) MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAANMFKMAKNWSAAGNAFCQAAK LHMQLQSKHDSATSFVDAGNAYKKADPQEAINCLNAAIDIYTDMGRFTIAAKHHITIAEIYETELVDIEK AIAHYEQSADYYKGEESNSSANKCLLKVAAYAAQLEQYQKAIEIYEQVGANTMDNPLLKYSAKDYFFKAA LCHFIVDELNAKLALEKYEEMFPAFTDSRECKLLKKLLEAHEEQNSEAYTEAVKEFDSISRLDQWLTTML LRIKKSIQGDGEGDGDLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071363 |
Locus ID | 63908 |
UniProt ID | Q9H115 |
Refseq Size | 3871 |
Cytogenetics | 20p11.21 |
Refseq ORF | 894 |
Synonyms | SNAP-BETA; SNAPB |
Summary | This gene encodes a member of the soluble N-ethyl-maleimide-sensitive fusion attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. This gene encodes the SNAP beta isoform which has been shown to be preferentially expressed in brain tissue. The encoded protein also interacts with the GluR2 α-amino-3-hydroxy-5-methyl-4-isoxazolepropionate (AMPA) receptor subunit C-terminus and may play a role as a chaperone in the molecular processing of the AMPA receptor. [provided by RefSeq, Mar 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411803 | NAPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411803 | Transient overexpression lysate of N-ethylmaleimide-sensitive factor attachment protein, beta (NAPB) |
CNY 3,080.00 |
|
PH309278 | NAPB MS Standard C13 and N15-labeled recombinant protein (NP_071363) |
CNY 19,520.00 |
其它SNAP-beta产品