Dermcidin (DCD) (NM_053283) Human Recombinant Protein
CAT#: TP309352L
Recombinant protein of human dermcidin (DCD), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209352 protein sequence
Red=Cloning site Green=Tags(s) MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGL DGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_444513 |
Locus ID | 117159 |
UniProt ID | P81605 |
Refseq Size | 645 |
Cytogenetics | 12q13.2 |
Refseq ORF | 330 |
Synonyms | AIDD; DCD-1; DSEP; HCAP; PIF |
Summary | This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
其它Dermcidin产品