GRP (LGALSL) (NM_014181) Human Recombinant Protein
CAT#: TP309358
Recombinant protein of human galectin-related protein (HSPC159), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209358 protein sequence
Red=Cloning site Green=Tags(s) MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAIS LTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVD GHQLFDFYHRIQTLSAIDTIKINGDLQITKLG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054900 |
Locus ID | 29094 |
UniProt ID | Q3ZCW2 |
Refseq Size | 3842 |
Cytogenetics | 2p14 |
Refseq ORF | 516 |
Synonyms | GRP; HSPC159 |
Summary | Does not bind lactose, and may not bind carbohydrates.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415454 | LGALSL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415454 | Transient overexpression lysate of galectin-related protein (HSPC159) |
CNY 3,080.00 |
|
PH309358 | HSPC159 MS Standard C13 and N15-labeled recombinant protein (NP_054900) |
CNY 14,250.00 |
|
TP720855 | Purified recombinant protein of Human galectin-related protein (HSPC159) |
CNY 3,140.00 |