United States
Germany
Japan
United Kingdom
China
Amyloid Precursor Protein (APP) (NM_201413) Human Recombinant Protein
CAT＃: TP309575
Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 2, 20 µg
View other "Amyloid Precursor Protein" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 4 publications. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209575 representing NM_201413
Red=Cloning site Green=Tags(s) MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT ESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAIPTTAA STPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKV ESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTL KHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLAN MISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRG LTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVIT LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 83 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Enzyme substrate (PMID: 25724648) |
| Reference Data | |
| RefSeq | NP_958816 |
| Locus ID | 351 |
| UniProt ID | P05067 |
| Refseq Size | 3584 |
| Cytogenetics | 21q21.3 |
| Refseq ORF | 2253 |
| Synonyms | AAA; ABETA; ABPP; AD1; alpha-sAPP; APPI; CTFgamma; CVAP; PN-II; PN2; preA4 |
| Summary | This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Aug 2014] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Alzheimer's disease |
Citations (4)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Chemoproteomic Profiling of Acetanilide Herbicides Reveals Their Role in Inhibiting Fatty Acid Oxidation
,Counihan, JL;Duckering, M;Dalvie, E;Ku, WM;Bateman, LA;Fisher, KJ;Nomura, DK;,
ACS Chem. Biol
,PubMed ID 28094496
[APP]
|
|
Specific Amyloid ß Clearance by a Catalytic Antibody Construct
,Planque, SA;Nishiyama, Y;Sonoda, S;Lin, Y;Taguchi, H;Hara, M;Kolodziej, S;Mitsuda, Y;Gonzalez, V;Sait, HB;Fukuchi, KI;Massey, RJ;Friedland, RP;O'Nuallain, B;Sigurdsson, EM;Paul, S;,
J. Biol. Chem.
,PubMed ID 25724648
[APP]
|
|
Centaurin-?1-Ras-Elk-1 Signaling at Mitochondria Mediates ?-Amyloid-Induced Synaptic Dysfunction
,null,
The Journal of Neuroscience
,PubMed ID 23516302
[APP]
|
|
Brain regional correlation of amyloid-? with synapses and apolipoprotein E in non-demented individuals: potential mechanisms underlying regional vulnerability to amyloid-? accumulation
,null,
Acta neuropathologica
,PubMed ID 23371365
[APP]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404408 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404409 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424694 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC427815 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404408 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 2 |
CNY 3,080.00 |
|
| LY404409 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 3 |
CNY 4,840.00 |
|
| LY424694 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 1 |
CNY 4,840.00 |
|
| LY427815 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 5 |
CNY 3,080.00 |
|
| PH309575 | APP MS Standard C13 and N15-labeled recombinant protein (NP_958816) |
CNY 19,520.00 |
|
| PH315147 | APP MS Standard C13 and N15-labeled recombinant protein (NP_958817) |
CNY 19,520.00 |
|
| TP315147 | Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它Amyloid Precursor Protein产品
