ADPRH (NM_001125) Human Recombinant Protein
CAT#: TP309618
Recombinant protein of human ADP-ribosylarginine hydrolase (ADPRH), 20 µg
View other "ADPRH" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209618 protein sequence
Red=Cloning site Green=Tags(s) MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEA GKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGL RFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSG YFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYD AVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSK EDTVISL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001116 |
Locus ID | 141 |
UniProt ID | P54922 |
Refseq Size | 3704 |
Cytogenetics | 3q13.33 |
Refseq ORF | 1071 |
Synonyms | ARH1; hARH1 |
Summary | The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes that require DTT for maximal activity, the human enzyme is DTT-independent. Alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, May 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400452 | ADPRH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400452 | Transient overexpression lysate of ADP-ribosylarginine hydrolase (ADPRH) |
CNY 3,080.00 |
|
PH309618 | ADPRH MS Standard C13 and N15-labeled recombinant protein (NP_001116) |
CNY 19,520.00 |
|
TP720544 | Recombinant protein of human ADP-ribosylarginine hydrolase (ADPRH) |
CNY 3,140.00 |