HMBOX1 (NM_024567) Human Recombinant Protein
CAT#: TP309647
Recombinant protein of human homeobox containing 1 (HMBOX1), transcript variant 1, 20 µg
View other "HMBOX1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209647 protein sequence
Red=Cloning site Green=Tags(s) MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGS SYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHAN SMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQG SDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLA VMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILES HGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078843 |
Locus ID | 79618 |
UniProt ID | Q6NT76 |
Refseq Size | 3233 |
Cytogenetics | 8p21.1-p12 |
Refseq ORF | 1260 |
Synonyms | HNF1LA; HOT1; PBHNF; TAH1 |
Summary | Binds directly to 5'-TTAGGG-3' repeats in telomeric DNA (PubMed:23813958, PubMed:23685356). Associates with the telomerase complex at sites of active telomere processing and positively regulates telomere elongation (PubMed:23685356). Important for TERT binding to chromatin, indicating a role in recruitment of the telomerase complex to telomeres (By similarity). Also plays a role in the alternative lengthening of telomeres (ALT) pathway in telomerase-negative cells where it promotes formation and/or maintenance of ALT-associated promyelocytic leukemia bodies (APBs) (PubMed:23813958). Enhances formation of telomere C-circles in ALT cells, suggesting a possible role in telomere recombination (PubMed:23813958). Might also be involved in the DNA damage response at telomeres (PubMed:23813958).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411234 | HMBOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427683 | HMBOX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411234 | Transient overexpression lysate of homeobox containing 1 (HMBOX1), transcript variant 1 |
CNY 3,080.00 |
|
LY427683 | Transient overexpression lysate of homeobox containing 1 (HMBOX1), transcript variant 2 |
CNY 3,080.00 |
|
PH309647 | HMBOX1 MS Standard C13 and N15-labeled recombinant protein (NP_078843) |
CNY 19,520.00 |
|
TP761488 | Purified recombinant protein of Human homeobox containing 1 (HMBOX1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2,040.00 |