Meis homeobox 3 (MEIS3) (NM_001009813) Human Recombinant Protein
CAT#: TP309662
Recombinant protein of human Meis homeobox 3 (MEIS3), transcript variant 2, 20 µg
View other "Meis homeobox 3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209662 protein sequence
Red=Cloning site Green=Tags(s) MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLA LVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVL RFHLLELEKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLAS QSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQ LAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLN LEGEWHYL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001009813 |
Locus ID | 56917 |
UniProt ID | Q99687, A0A024R0S2 |
Refseq Size | 1977 |
Cytogenetics | 19q13.32 |
Refseq ORF | 1074 |
Synonyms | MRG2 |
Summary | This gene encodes a homeobox protein and probable transcriptional regulator. The orthologous protein in mouse controls expression of 3-phosphoinositide dependent protein kinase 1, which promotes survival of pancreatic beta-cells. [provided by RefSeq, Sep 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412624 | MEIS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422933 | MEIS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412624 | Transient overexpression lysate of Meis homeobox 3 (MEIS3), transcript variant 1 |
CNY 3,080.00 |
|
LY422933 | Transient overexpression lysate of Meis homeobox 3 (MEIS3), transcript variant 2 |
CNY 3,080.00 |
|
PH306100 | MEIS3 MS Standard C13 and N15-labeled recombinant protein (NP_064545) |
CNY 19,520.00 |
|
PH309662 | MEIS3 MS Standard C13 and N15-labeled recombinant protein (NP_001009813) |
CNY 19,520.00 |
|
TP306100 | Recombinant protein of human Meis homeobox 3 (MEIS3), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Meis homeobox 3产品