Grainyhead like protein 1 homolog (GRHL1) (NM_014552) Human Recombinant Protein
CAT#: TP309683
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 20 µg
View other "Grainyhead like protein 1 homolog" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209683 protein sequence
Red=Cloning site Green=Tags(s) MTQEYDNKRPVLVLQNEALYPQRRSYTSEDEAWKSFLENPLTAATKAMMSINGDEDSAAALGLLYDYYKV PRERRSSTAKPEVEHPEPDHSKRNSIPIVTEQPLISAGENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTA PDTTVTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEPTERVVVFDRNLNTDQFSSGAQAPNAQRRTPD STFSETFKEGVQEVFFPSDLSLRMPGMNSEDYVFDSVSGNNFEYTLEASKSLRQKPGDSTMTYLNKGQFY PITLKEVSSSEGIHHPISKVRSVIMVVFAEDKSREDQLRHWKYWHSRQHTAKQRCIDIADYKESFNTISN VEEIAYNAISFTWDINDEAKVFISVNCLSTDFSSQKGVKGLPLNIQIDTYSYNNRSNKPVHRAYCQIKVF CDKGAERKIRDEERKQSKRKVSDVKVPLLPSHKRMDITVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLP IASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGLMEAI SDKYDVPHDKIGKIFKKCKKGILVNMDDNIVKHYSNEDTFQLQIEEAGGSYKLTLTEI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055367 |
Locus ID | 29841 |
UniProt ID | Q9NZI5 |
Refseq Size | 3610 |
Cytogenetics | 2p25.1 |
Refseq ORF | 1854 |
Synonyms | grainyhead-like 1 (Drosophila); LBP-32; LBP32; LBP protein 32; leader-binding protein 32; mammalian grainyhead; MGR; TFCP2L2; transcription factor CP2-like 2 |
Summary | This gene encodes a member of the grainyhead family of transcription factors. The encoded protein can exist as a homodimer or can form heterodimers with sister-of-mammalian grainyhead or brother-of-mammalian grainyhead. This protein functions as a transcription factor during development. [provided by RefSeq, Jun 2009] |
Protein Families | Transcription Factors, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402346 | GRHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432329 | GRHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402346 | Transient overexpression lysate of grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1 |
CNY 3,080.00 |
|
LY432329 | Transient overexpression lysate of grainyhead-like 1 (Drosophila) (GRHL1) |
CNY 3,080.00 |
|
PH309683 | GRHL1 MS Standard C13 and N15-labeled recombinant protein (NP_055367) |
CNY 19,520.00 |
|
TP329312 | Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), 20 µg |
CNY 2,900.00 |
其它Grainyhead like protein 1 homolog产品