CDC26 (NM_139286) Human Recombinant Protein
CAT#: TP309719
Recombinant protein of human cell division cycle 26 homolog (S. cerevisiae) (CDC26), 20 µg
View other "CDC26" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 6,281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209719 protein sequence
Red=Cloning site Green=Tags(s) MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ PKPNNRSSQFGSLEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_644815 |
Locus ID | 246184 |
UniProt ID | Q8NHZ8 |
Refseq Size | 885 |
Cytogenetics | 9q32 |
Refseq ORF | 255 |
Synonyms | ANAPC12; APC12; C9orf17 |
Summary | The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. [provided by RefSeq, Jul 2008] |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408342 | CDC26 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408342 | Transient overexpression lysate of cell division cycle 26 homolog (S. cerevisiae) (CDC26) |
CNY 3,080.00 |
|
PH309719 | CDC26 MS Standard C13 and N15-labeled recombinant protein (NP_644815) |
CNY 19,520.00 |