XAGE2 (NM_130777) Human Recombinant Protein
CAT#: TP309757
Recombinant protein of human X antigen family, member 2 (XAGE2), 20 µg
View other "XAGE2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209757 protein sequence
Red=Cloning site Green=Tags(s) MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADL QELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_570133 |
Locus ID | 9502 |
UniProt ID | Q96GT9, A0A024R2A6 |
Refseq Size | 651 |
Cytogenetics | Xp11.22 |
Refseq ORF | 333 |
Synonyms | CT12.2; GAGED3; XAGE-2; XAGE2B |
Summary | This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408939 | XAGE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408939 | Transient overexpression lysate of X antigen family, member 2 (XAGE2) |
CNY 3,080.00 |
|
PH309757 | XAGE2 MS Standard C13 and N15-labeled recombinant protein (NP_570133) |
CNY 19,520.00 |