PSMD14 (NM_005805) Human Recombinant Protein
CAT#: TP309829
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (PSMD14), 20 µg
View other "PSMD14" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209829 protein sequence
Red=Cloning site Green=Tags(s) MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVI DVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERA VAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN ELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDP KRHLEEHVDVLMTSNIVQCLAAMLDTVVFK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005796 |
Locus ID | 10213 |
UniProt ID | O00487, A0A140VKF2 |
Refseq Size | 1734 |
Cytogenetics | 2q24.2 |
Refseq ORF | 930 |
Synonyms | PAD1; POH1; RPN11 |
Summary | This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S proteasome and mediates substrate deubiquitination. A pseudogene of this gene is also located on the long arm of chromosome 2. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401764 | PSMD14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401764 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (PSMD14) |
CNY 3,080.00 |
|
PH309829 | PSMD14 MS Standard C13 and N15-labeled recombinant protein (NP_005796) |
CNY 19,520.00 |