RETREG1 (NM_019000) Human Recombinant Protein
CAT#: TP309916
Recombinant protein of human family with sequence similarity 134, member B (FAM134B), transcript variant 2, 20 µg
View other "RETREG1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209916 protein sequence
Red=Cloning site Green=Tags(s) MPEGEDFGPGKSWEVINSKPDERPRLSHCIAESWMNFSIFLQEMSLFKQQSPGKFCLLVCSVCTFFTILG SYIPGVILSYLLLLCAFLCPLFKCNDIGQKIYSKIKSVLLKLDFGIGEYINQKKRERSEADKEKSHKDDS ELDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFP SLENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAV TAAIKDQLEGVQQALSQAAPIPEEDTDTEEGDDFELLDQSELDQIESELGLTQDQEAEAQQNKKSSGFLS NLLGGH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061873 |
Locus ID | 54463 |
UniProt ID | Q9H6L5 |
Refseq Size | 3184 |
Cytogenetics | 5p15.1 |
Refseq ORF | 1068 |
Synonyms | FAM134B; JK-1; JK1 |
Summary | The protein encoded by this gene is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Mutations in this gene are a cause of hereditary sensory and autonomic neuropathy type IIB (HSAN IIB), and this gene may also play a role in susceptibility to vascular dementia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412838 | FAM134B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412838 | Transient overexpression lysate of family with sequence similarity 134, member B (FAM134B), transcript variant 2 |
CNY 3,080.00 |
|
PH309916 | FAM134B MS Standard C13 and N15-labeled recombinant protein (NP_061873) |
CNY 19,520.00 |
其它RETREG1产品