INSL3 (NM_005543) Human Recombinant Protein
CAT#: TP309944
Recombinant protein of human insulin-like 3 (Leydig cell) (INSL3), 20 µg
View other "INSL3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209944 protein sequence
Red=Cloning site Green=Tags(s) MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDRELLQWL ERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005534 |
Locus ID | 3640 |
UniProt ID | P51460 |
Refseq Size | 833 |
Cytogenetics | 19p13.11 |
Refseq ORF | 393 |
Synonyms | ley-I-L; RLF; RLNL |
Summary | This gene encodes a member of the insulin-like hormone superfamily. The encoded protein is mainly produced in gonadal tissues. Studies of the mouse counterpart suggest that this gene may be involved in the development of urogenital tract and female fertility. This protein may also act as a hormone to regulate growth and differentiation of gubernaculum, and thus mediating intra-abdominal testicular descent. Mutations in this gene may lead to cryptorchidism. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417236 | INSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417236 | Transient overexpression lysate of insulin-like 3 (Leydig cell) (INSL3) |
CNY 3,080.00 |
|
PH309944 | INSL3 MS Standard C13 and N15-labeled recombinant protein (NP_005534) |
CNY 19,520.00 |
|
TP721235 | Purified recombinant protein of Human insulin-like 3 (Leydig cell) (INSL3) |
CNY 3,140.00 |