PTP4A2 (NM_080391) Human Recombinant Protein
CAT#: TP309983M
Recombinant protein of human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
货期*
4周
规格
经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209983 protein sequence
Red=Cloning site Green=Tags(s) MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDG APPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNS KQLLYLEKYRPKMRLRFRDTNGHCCVQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_536316 |
Locus ID | 8073 |
UniProt ID | Q12974 |
Refseq Size | 3939 |
Cytogenetics | 1p35.2 |
Refseq ORF | 501 |
Synonyms | HH7-2; HH13; HU-PP-1; OV-1; PRL-2; PRL2; ptp-IV1a; ptp-IV1b; PTP4A; PTPCAAX2 |
Summary | The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17. [provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...