IL22 (NM_020525) Human Recombinant Protein
CAT#: TP309995
Recombinant protein of human interleukin 22 (IL22), 20 µg
View other "IL22" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209995 protein sequence
Red=Cloning site Green=Tags(s) MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNT DVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLH IQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065386 |
Locus ID | 50616 |
UniProt ID | Q9GZX6 |
Refseq Size | 1147 |
Cytogenetics | 12q15 |
Refseq ORF | 537 |
Synonyms | IL-21; IL-22; IL-D110; IL-TIF; ILTIF; TIFa; TIFIL-23; zcyto18 |
Summary | This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. [provided by RefSeq, Jul 2018] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412429 | IL22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412429 | Transient overexpression lysate of interleukin 22 (IL22) |
CNY 3,080.00 |
|
PH309995 | IL22 MS Standard C13 and N15-labeled recombinant protein (NP_065386) |
CNY 19,520.00 |
|
TP721182 | Purified recombinant protein of Human interleukin 22 (IL22) |
CNY 3,140.00 |
|
TP723717 | Purified recombinant protein of Human interleukin 22 (IL22) |
CNY 5,330.00 |