MARCKS (NM_002356) Human Recombinant Protein
CAT#: TP310277
Recombinant protein of human myristoylated alanine-rich protein kinase C substrate (MARCKS), 20 µg
View other "MARCKS" proteins (1)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210277 representing NM_002356
Red=Cloning site Green=Tags(s) MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKE EPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAED GATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGEGGEAEAPAAEGGKDEAAGGAAAAAAEAGAA SGEQAAAPGEEAAAGEEGAAGGDPQEAKPQEAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACE APSAAGPGAPPEQEAAPAEEPAAAAASSACAAPSQEAQPECSPEAPPAEAAE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Binding assay (PMID: 25863174) |
Reference Data | |
RefSeq | NP_002347 |
Locus ID | 4082 |
UniProt ID | P29966 |
Refseq Size | 2589 |
Cytogenetics | 6q21 |
Refseq ORF | 996 |
Synonyms | 80K-L; MACS; PKCSL; PRKCSL |
Summary | The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Fc gamma R-mediated phagocytosis |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Identification of novel phosphatidic acid-binding proteins in the rat brain
,Park, C;Kang, DS;Shin, GH;Seo, J;Kim, H;Suh, PG;Bae, CD;Shin, JH;,
Neurosci. Lett.
,PubMed ID 25863174
[MARCKS]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH310277 | MARCKS MS Standard C13 and N15-labeled recombinant protein (NP_002347) |
CNY 14,250.00 |