GNA11 (NM_002067) Human Recombinant Protein
CAT#: TP310292
Recombinant protein of human guanine nucleotide binding protein (G protein), alpha 11 (Gq class) (GNA11), 20 µg
View other "GNA11" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210292 protein sequence
Red=Cloning site Green=Tags(s) MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEE DKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPG IQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQR SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE DKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ LNLKEYNLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002058 |
Locus ID | 2767 |
UniProt ID | P29992 |
Refseq Size | 4145 |
Cytogenetics | 19p13.3 |
Refseq ORF | 1077 |
Synonyms | FBH; FBH2; FHH2; GNA-11; HHC2; HYPOC2 |
Summary | The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations. [provided by RefSeq, Dec 2013] |
Protein Pathways | Calcium signaling pathway, Gap junction, GnRH signaling pathway, Long-term depression, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419559 | GNA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419559 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha 11 (Gq class) (GNA11) |
CNY 3,080.00 |
|
PH310292 | GNA11 MS Standard C13 and N15-labeled recombinant protein (NP_002058) |
CNY 19,520.00 |