CD226 (NM_006566) Human Recombinant Protein
CAT#: TP310437
Recombinant protein of human CD226 molecule (CD226), 20 µg
View other "CD226" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210437 protein sequence
Red=Cloning site Green=Tags(s) MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMV IRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIP DVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRR RERRDLFTESWDTQKAPNNYRSPISTGQPTNQSMDDTREDIYVNYPTFSRRPKTRV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006557 |
Locus ID | 10666 |
UniProt ID | Q15762 |
Refseq Size | 2664 |
Cytogenetics | 18q22.2 |
Refseq ORF | 1008 |
Synonyms | DNAM-1; DNAM1; PTA1; TLiSA1 |
Summary | This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416555 | CD226 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416555 | Transient overexpression lysate of CD226 molecule (CD226) |
CNY 3,080.00 |
|
PH310437 | CD226 MS Standard C13 and N15-labeled recombinant protein (NP_006557) |
CNY 19,520.00 |
|
TP701017 | Purified recombinant protein of Human CD226 molecule (CD226), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,106.00 |
|
TP723967 | Human DNAM-1 Protein, mFc-His Tag |
CNY 5,876.00 |